Class a: All alpha proteins [46456] (202 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (2 families) |
Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
Protein Sigma factor SigA [88668] (1 species) |
Species Thermus aquaticus [TaxId:271] [88669] (3 PDB entries) |
Domain d1rioh_: 1rio H: [97515] Other proteins in same PDB: d1rioa_, d1riob_ complexed with ca, mpd |
PDB Entry: 1rio (more details), 2.3 Å
SCOP Domain Sequences for d1rioh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rioh_ a.4.13.2 (H:) Sigma factor SigA {Thermus aquaticus} seelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqienkalrklky h
Timeline for d1rioh_: