Lineage for d1rioh_ (1rio H:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 352353Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (2 families) (S)
  5. 352370Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 352371Protein Sigma factor SigA [88668] (1 species)
  7. 352372Species Thermus aquaticus [TaxId:271] [88669] (3 PDB entries)
  8. 352374Domain d1rioh_: 1rio H: [97515]
    Other proteins in same PDB: d1rioa_, d1riob_
    complexed with ca, mpd

Details for d1rioh_

PDB Entry: 1rio (more details), 2.3 Å

PDB Description: Structure of bacteriophage lambda cI-NTD in complex with sigma-region4 of Thermus aquaticus bound to DNA

SCOP Domain Sequences for d1rioh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rioh_ a.4.13.2 (H:) Sigma factor SigA {Thermus aquaticus}
seelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqienkalrklky
h

SCOP Domain Coordinates for d1rioh_:

Click to download the PDB-style file with coordinates for d1rioh_.
(The format of our PDB-style files is described here.)

Timeline for d1rioh_: