![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
![]() | Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
![]() | Protein Sigma70 (SigA, RpoD) [88666] (4 species) Pfam PF03979 |
![]() | Species Thermus aquaticus [TaxId:271] [88669] (3 PDB entries) |
![]() | Domain d1rioh_: 1rio H: [97515] Other proteins in same PDB: d1rioa1, d1rioa2, d1riob1, d1riob2 protein/DNA complex; complexed with ca, mpd |
PDB Entry: 1rio (more details), 2.3 Å
SCOPe Domain Sequences for d1rioh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rioh_ a.4.13.2 (H:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} seelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqienkalrklky h
Timeline for d1rioh_:
![]() Domains from other chains: (mouse over for more information) d1rioa1, d1rioa2, d1riob1, d1riob2 |