Lineage for d1riob_ (1rio B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537276Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 537320Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)
  7. 537321Species Bacteriophage lambda [TaxId:10710] [47421] (4 PDB entries)
  8. 537327Domain d1riob_: 1rio B: [97514]
    Other proteins in same PDB: d1rioh_
    complexed with ca, mpd

Details for d1riob_

PDB Entry: 1rio (more details), 2.3 Å

PDB Description: Structure of bacteriophage lambda cI-NTD in complex with sigma-region4 of Thermus aquaticus bound to DNA

SCOP Domain Sequences for d1riob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1riob_ a.35.1.2 (B:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda}
stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
naallakilkvsveefspsiareiyemyeavhhhhh

SCOP Domain Coordinates for d1riob_:

Click to download the PDB-style file with coordinates for d1riob_.
(The format of our PDB-style files is described here.)

Timeline for d1riob_: