![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) ![]() |
![]() | Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
![]() | Protein lambda C1 repressor, DNA-binding domain [47420] (1 species) |
![]() | Species Bacteriophage lambda [TaxId:10710] [47421] (4 PDB entries) |
![]() | Domain d1rioa_: 1rio A: [97513] Other proteins in same PDB: d1rioh_ |
PDB Entry: 1rio (more details), 2.3 Å
SCOP Domain Sequences for d1rioa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rioa_ a.35.1.2 (A:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda} stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay naallakilkvsveefspsiareiyemyeavhhhhhh
Timeline for d1rioa_: