Lineage for d1rihh2 (1rih H:114-215)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655538Domain d1rihh2: 1rih H:114-215 [97510]
    Other proteins in same PDB: d1rihh1, d1rihl1, d1rihl2
    part of Fab 14F7

Details for d1rihh2

PDB Entry: 1rih (more details), 2.5 Å

PDB Description: crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
PDB Compounds: (H:) heavy chain of antibody 14F7

SCOP Domain Sequences for d1rihh2:

Sequence, based on SEQRES records: (download)

>d1rihh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Sequence, based on observed residues (ATOM records): (download)

>d1rihh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1rihh2:

Click to download the PDB-style file with coordinates for d1rihh2.
(The format of our PDB-style files is described here.)

Timeline for d1rihh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rihh1