Lineage for d1rifb_ (1rif B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597864Family c.37.1.23: DNA helicase UvsW [102396] (1 protein)
    contains extra N-terminal alpha+beta subdomain
  6. 1597865Protein DNA helicase UvsW [102397] (1 species)
  7. 1597866Species Bacteriophage T4 [TaxId:10665] [102398] (1 PDB entry)
  8. 1597868Domain d1rifb_: 1rif B: [97508]
    complexed with au, mg

Details for d1rifb_

PDB Entry: 1rif (more details), 2 Å

PDB Description: crystal structure of the uvsw helicase from bacteriophage t4
PDB Compounds: (B:) DNA helicase uvsW

SCOPe Domain Sequences for d1rifb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rifb_ c.37.1.23 (B:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}
mdikvhfhdfshvridceestfhelrdffsfeadgyrfnprfrygnwdgrirlldynrll
pfglvgqikkfcdnfgykawidpqinekeelsrkdfdewlskleiysgnkriephwyqkd
avfeglvnrrrilnlptsagrsliqallaryylenyegkiliivpttalttqmaddfvdy
rlfshamikkigggaskddkykndapvvvgtwqtvvkqpkewfsqfgmmmndechlatgk
sissiisglnncmfkfglsgslrdgkanimqyvgmfgeifkp

SCOPe Domain Coordinates for d1rifb_:

Click to download the PDB-style file with coordinates for d1rifb_.
(The format of our PDB-style files is described here.)

Timeline for d1rifb_: