Lineage for d1rifa_ (1rif A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113825Family c.37.1.23: DNA helicase UvsW [102396] (1 protein)
    contains extra N-terminal alpha+beta subdomain
  6. 2113826Protein DNA helicase UvsW [102397] (1 species)
  7. 2113827Species Bacteriophage T4 [TaxId:10665] [102398] (1 PDB entry)
  8. 2113828Domain d1rifa_: 1rif A: [97507]
    complexed with au, mg

Details for d1rifa_

PDB Entry: 1rif (more details), 2 Å

PDB Description: Crystal structure of the UvsW helicase from Bacteriophage T4
PDB Compounds: (A:) DNA helicase uvsW

SCOPe Domain Sequences for d1rifa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}
mdikvhfhdfshvridceestfhelrdffsfeadgyrfnprfrygnwdgrirlldynrll
pfglvgqikkfcdnfgykawidpqinekeelsrkdfdewlskleiysgnkriephwyqkd
avfeglvnrrrilnlptsagrsliqallaryylenyegkiliivpttalttqmaddfvdy
rlfshamikkigggaskddkykndapvvvgtwqtvvkqpkewfsqfgmmmndechlatgk
sissiisglnncmfkfglsgslrdgkanimqyvgmfgeifkp

SCOPe Domain Coordinates for d1rifa_:

Click to download the PDB-style file with coordinates for d1rifa_.
(The format of our PDB-style files is described here.)

Timeline for d1rifa_: