Lineage for d1ri6a1 (1ri6 A:4-333)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066455Superfamily b.69.11: Putative isomerase YbhE [101908] (1 family) (S)
    automatically mapped to Pfam PF10282
  5. 2066456Family b.69.11.1: Putative isomerase YbhE [101909] (1 protein)
  6. 2066457Protein Putative isomerase YbhE [101910] (1 species)
  7. 2066458Species Escherichia coli [TaxId:562] [101911] (1 PDB entry)
  8. 2066459Domain d1ri6a1: 1ri6 A:4-333 [97503]
    Other proteins in same PDB: d1ri6a2, d1ri6a3
    structural genomics

Details for d1ri6a1

PDB Entry: 1ri6 (more details), 2 Å

PDB Description: Structure of a putative isomerase from E. coli
PDB Compounds: (A:) putative isomerase ybhE

SCOPe Domain Sequences for d1ri6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ri6a1 b.69.11.1 (A:4-333) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}
kqtvyiaspesqqihvwnlnhegaltltqvvdvpgqvqpmvvspdkrylyvgvrpefrvl
ayriapddgaltfaaesalpgslthistdhqgqfvfvgsynagnvsvtrledglpvgvvd
vvegldgchsanispdnrtlwvpalkqdriclftvsddghlvaqdpaevttvegagprhm
vfhpneqyaycvnelnssvdvwelkdphgniecvqtldmmpenfsdtrwaadihitpdgr
hlyacdrtaslitvfsvsedgsvlskegfqptetqprgfnvdhsgkyliaagqkshhisv
yeivgeqgllhekgryavgqgpmwvvvnah

SCOPe Domain Coordinates for d1ri6a1:

Click to download the PDB-style file with coordinates for d1ri6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ri6a1: