Lineage for d1ri4a_ (1ri4 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399355Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 399356Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (38 families) (S)
  5. 399717Family c.66.1.34: mRNA cap (Guanine N-7) methyltransferase [102560] (1 protein)
    mRNA capping enzyme
  6. 399718Protein mRNA cap (Guanine N-7) methyltransferase [102561] (1 species)
  7. 399719Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [102562] (5 PDB entries)
  8. 399721Domain d1ri4a_: 1ri4 A: [97501]
    complexed with sam

Details for d1ri4a_

PDB Entry: 1ri4 (more details), 2.4 Å

PDB Description: Structure and mechanism of mRNA cap (guanine N-7) methyltransferase

SCOP Domain Sequences for d1ri4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ri4a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi)}
sktinirnannfikaclirlytkrgdsvldlgcgkggdllkyeragigeyygvdiaevsi
ndarvrarnmkrrfkvffraqdsygrhmdlgkefdvissqfsfhyafstsesldiaqrni
arhlrpggyfimtvpsrdvilerykqgrmsndfykielekmedvpmesvreyrftlldsv
nncieyfvdftrmvdgfkrlglslverkgfidfyedegrrnpelskkmglgcltreesev
vgiyevvvfrkl

SCOP Domain Coordinates for d1ri4a_:

Click to download the PDB-style file with coordinates for d1ri4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ri4a_: