![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.6: Sec-beta or SecG subunit of protein translocation channel [267595] (2 families) ![]() |
![]() | Family f.17.6.1: Sec-beta subunit [267608] (1 protein) |
![]() | Protein Sec-beta subunit [267634] (2 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [267695] (4 PDB entries) |
![]() | Domain d1rhzc_: 1rhz C: [97497] Other proteins in same PDB: d1rhza_, d1rhzb_ |
PDB Entry: 1rhz (more details), 3.5 Å
SCOPe Domain Sequences for d1rhzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhzc_ f.17.6.1 (C:) Sec-beta subunit {Methanococcus jannaschii [TaxId: 2190]} etfskirvkpehvigvtvafviieailtygrf
Timeline for d1rhzc_: