Lineage for d1rhzc_ (1rhz C:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426178Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 426580Superfamily f.23.29: Sec-beta subunit [103460] (1 family) (S)
  5. 426581Family f.23.29.1: Sec-beta subunit [103461] (1 protein)
  6. 426582Protein Sec-beta subunit [103462] (1 species)
  7. 426583Species Archaeon Methanococcus jannaschii [TaxId:2190] [103463] (2 PDB entries)
  8. 426585Domain d1rhzc_: 1rhz C: [97497]
    Other proteins in same PDB: d1rhza_, d1rhzb_

Details for d1rhzc_

PDB Entry: 1rhz (more details), 3.5 Å

PDB Description: The structure of a protein conducting channel

SCOP Domain Sequences for d1rhzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhzc_ f.23.29.1 (C:) Sec-beta subunit {Archaeon Methanococcus jannaschii}
etfskirvkpehvigvtvafviieailtygrf

SCOP Domain Coordinates for d1rhzc_:

Click to download the PDB-style file with coordinates for d1rhzc_.
(The format of our PDB-style files is described here.)

Timeline for d1rhzc_: