SCOPe 2.07: Domain d1rhzb_: 1rhz B:

Lineage for d1rhzb_ (1rhz B:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family)

5. Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein)

6. Protein Preprotein translocase SecE subunit [103458] (3 species)

7. Species Methanococcus jannaschii [TaxId:2190] [103459] (4 PDB entries)

8. Domain d1rhzb_: 1rhz B: [97496]
   Other proteins in same PDB: d1rhza_, d1rhzc_

Details for d1rhzb_

PDB Entry: 1rhz, 3.5 Å

PDB Description: The structure of a protein conducting channel

PDB Compounds: (B:) Preprotein translocase secE subunit

SCOPe Domain Sequences for d1rhzb_:

Sequence; same for both SEQRES and ATOM records:

>d1rhzb_ f.23.28.1 (B:) Preprotein translocase SecE subunit {Methanococcus jannaschii [TaxId: 2190]}
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
kgilk

Timeline for d1rhzb_:

• d1rhzb_ first appeared in SCOP 1.67
  
• d1rhzb_ appears in SCOPe 2.06
  
• d1rhzb_ appears in the current release, SCOPe 2.08