![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family) ![]() |
![]() | Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein) |
![]() | Protein Preprotein translocase SecE subunit [103458] (2 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [103459] (4 PDB entries) |
![]() | Domain d1rhzb_: 1rhz B: [97496] Other proteins in same PDB: d1rhza_, d1rhzc_ |
PDB Entry: 1rhz (more details), 3.5 Å
SCOPe Domain Sequences for d1rhzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhzb_ f.23.28.1 (B:) Preprotein translocase SecE subunit {Methanococcus jannaschii [TaxId: 2190]} tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi kgilk
Timeline for d1rhzb_: