Lineage for d1rhzb_ (1rhz B:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 520313Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family) (S)
  5. 520314Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein)
  6. 520315Protein Preprotein translocase SecE subunit [103458] (1 species)
  7. 520316Species Archaeon Methanococcus jannaschii [TaxId:2190] [103459] (2 PDB entries)
  8. 520318Domain d1rhzb_: 1rhz B: [97496]
    Other proteins in same PDB: d1rhza_, d1rhzc_

Details for d1rhzb_

PDB Entry: 1rhz (more details), 3.5 Å

PDB Description: The structure of a protein conducting channel

SCOP Domain Sequences for d1rhzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhzb_ f.23.28.1 (B:) Preprotein translocase SecE subunit {Archaeon Methanococcus jannaschii}
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
kgilk

SCOP Domain Coordinates for d1rhzb_:

Click to download the PDB-style file with coordinates for d1rhzb_.
(The format of our PDB-style files is described here.)

Timeline for d1rhzb_: