Lineage for d1rhza_ (1rhz A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028340Fold f.41: Preprotein translocase SecY subunit [103490] (1 superfamily)
    10 transmembrane helices forming of a gated channel
  4. 3028341Superfamily f.41.1: Preprotein translocase SecY subunit [103491] (2 families) (S)
    duplication: consists of two similar structural parts
  5. 3028342Family f.41.1.1: Preprotein translocase SecY subunit [103492] (1 protein)
    automatically mapped to Pfam PF00344
  6. 3028343Protein Preprotein translocase SecY subunit [103493] (2 species)
  7. 3028344Species Methanococcus jannaschii [TaxId:2190] [103494] (2 PDB entries)
  8. 3028346Domain d1rhza_: 1rhz A: [97495]
    Other proteins in same PDB: d1rhzb_, d1rhzc_

Details for d1rhza_

PDB Entry: 1rhz (more details), 3.5 Å

PDB Description: The structure of a protein conducting channel
PDB Compounds: (A:) Preprotein translocase secY subunit

SCOPe Domain Sequences for d1rhza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhza_ f.41.1.1 (A:) Preprotein translocase SecY subunit {Methanococcus jannaschii [TaxId: 2190]}
kklipilekipevelpvkeitfkeklkwtgivlvlyfimgcidvytagaqipaifefwqt
itasrigtlitlgigpivtagiimqllvgsgiiqmdlsipenralfqgcqkllsiimcfv
eavlfvgagafgiltpllaflviiqiafgsiiliyldeivskygigsgiglfiaagvsqt
ifvgalgpegylwkflnsliqgvpnieyiapiigtiivflmvvyaecmrveiplahgrik
gavgkypikfvyvsnipvilaaalfaniqlwglalyrmgipilghyeggravdgiayyls
tpyglssvisdpihaivymiamiitcvmfgifwvettgldpksmakrigslgmaikgfrk
sekaiehrlkryippltvmssafvgflatianfigalgggtgvlltvsivyrmyeqllre
kvselhpaiakl

SCOPe Domain Coordinates for d1rhza_:

Click to download the PDB-style file with coordinates for d1rhza_.
(The format of our PDB-style files is described here.)

Timeline for d1rhza_: