Lineage for d1rhya2 (1rhy A:94-187)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407595Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 407596Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) (S)
  5. 407808Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein)
    duplication; there are two structural repeats of this fold
  6. 407809Protein Imidazole glycerol phosphate dehydratase [102767] (1 species)
  7. 407810Species Fungus (Filobasidiella neoformans) [TaxId:5207] [102768] (1 PDB entry)
  8. 407812Domain d1rhya2: 1rhy A:94-187 [97492]

Details for d1rhya2

PDB Entry: 1rhy (more details), 2.3 Å

PDB Description: crystal structure of imidazole glycerol phosphate dehydratase

SCOP Domain Sequences for d1rhya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhya2 d.14.1.9 (A:94-187) Imidazole glycerol phosphate dehydratase {Fungus (Filobasidiella neoformans)}
gikrygyayapldeslsravidissrpyfmchlpftrekvgdlstemvshllqsfafaag
vtlhidsirgennhhiaesafkalalairmaisr

SCOP Domain Coordinates for d1rhya2:

Click to download the PDB-style file with coordinates for d1rhya2.
(The format of our PDB-style files is described here.)

Timeline for d1rhya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rhya1