SCOP 1.69: Domain d1rhwa_: 1rhw A:

Lineage for d1rhwa_ (1rhw A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)

5. Family d.39.1.1: DLC [54649] (2 proteins)
   8 kDa dynein light chain, DLC8

6. Protein Dynein light chain 1 (DLC1) [54650] (3 species)
   synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (1 PDB entry)

8. Domain d1rhwa_: 1rhw A: [97490]

Details for d1rhwa_

PDB Entry: 1rhw

PDB Description: the solution structure of the ph-induced monomer of dynein light chain lc8 from drosophila

SCOP Domain Sequences for d1rhwa_:

Sequence; same for both SEQRES and ATOM records:

>d1rhwa_ d.39.1.1 (A:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster)}
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfksg

Timeline for d1rhwa_:

• d1rhwa_ first appeared in SCOP 1.67
  
• d1rhwa_ appears in SCOP 1.71
  
• d1rhwa_ appears in the current release, SCOPe 2.08