Lineage for d1rhq.2 (1rhq D:,E:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2437680Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2437681Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2437682Family c.17.1.1: Caspase catalytic domain [52130] (8 protein domains)
  6. 2437683Protein Apopain (caspase-3, cpp32) [52131] (1 species)
  7. 2437684Species Human (Homo sapiens) [TaxId:9606] [52132] (28 PDB entries)
  8. 2437723Domain d1rhq.2: 1rhq D:,E: [97487]
    complexed with 0zz

Details for d1rhq.2

PDB Entry: 1rhq (more details), 3 Å

PDB Description: crystal structure of the complex of caspase-3 with a bromomethoxyphenyl inhibitor
PDB Compounds: (D:) Caspase-3, (E:) Caspase-3

SCOPe Domain Sequences for d1rhq.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1rhq.2 c.17.1.1 (D:,E:) Apopain (caspase-3, cpp32) {Human (Homo sapiens) [TaxId: 9606]}
dnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltr
eeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltg
kpklfiiqacrgteldcgieXkipveadflyaystapgyyswrnskdgswfiqslcamlk
qyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfy

SCOPe Domain Coordinates for d1rhq.2:

Click to download the PDB-style file with coordinates for d1rhq.2.
(The format of our PDB-style files is described here.)

Timeline for d1rhq.2: