Lineage for d1rhm.2 (1rhm C:,D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390644Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 390645Superfamily c.17.1: Caspase-like [52129] (2 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 390646Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins)
  6. 390647Protein Apopain (caspase-3, cpp32) [52131] (1 species)
  7. 390648Species Human (Homo sapiens) [TaxId:9606] [52132] (15 PDB entries)
  8. 390662Domain d1rhm.2: 1rhm C:,D: [97485]
    complexed with na4

Details for d1rhm.2

PDB Entry: 1rhm (more details), 2.5 Å

PDB Description: crystal structure of the complex of caspase-3 with a nicotinic acid aldehyde inhibitor

SCOP Domain Sequences for d1rhm.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1rhm.2 c.17.1.1 (C:,D:) Apopain (caspase-3, cpp32) {Human (Homo sapiens)}
dnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltr
eeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltg
kpklfiiqacrgteldcgieXkipveadflyaystapgyyswrnskdgswfiqslcamlk
qyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfy

SCOP Domain Coordinates for d1rhm.2:

Click to download the PDB-style file with coordinates for d1rhm.2.
(The format of our PDB-style files is described here.)

Timeline for d1rhm.2: