Lineage for d1rhhd1 (1rhh D:4-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 450971Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (16 PDB entries)
  8. 450981Domain d1rhhd1: 1rhh D:4-113 [97479]
    Other proteins in same PDB: d1rhha1, d1rhha2, d1rhhb2, d1rhhc1, d1rhhc2, d1rhhd2
    part of HIV-1 neutralizing Fab x5

Details for d1rhhd1

PDB Entry: 1rhh (more details), 1.9 Å

PDB Description: Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution

SCOP Domain Sequences for d1rhhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhhd1 b.1.1.1 (D:4-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
lleqsgaevkkpgssvqvsckasggtfsmygfnwvrqapghglewmggiipifgtsnyaq
kfrgrvtftadqatstaymeltnlrsddtavyycardfgpdwedgdsydgsgrgffdfwg
qgtlvtvss

SCOP Domain Coordinates for d1rhhd1:

Click to download the PDB-style file with coordinates for d1rhhd1.
(The format of our PDB-style files is described here.)

Timeline for d1rhhd1: