SCOPe 2.01: Domain d1rhhc1: 1rhh C:1-106A

Lineage for d1rhhc1 (1rhh C:1-106A)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)

8. Domain d1rhhc1: 1rhh C:1-106A [97477]
   Other proteins in same PDB: d1rhha2, d1rhhb1, d1rhhb2, d1rhhc2, d1rhhd1, d1rhhd2
   part of HIV-1 neutralizing Fab x5

Details for d1rhhc1

PDB Entry: 1rhh, 1.9 Å

PDB Description: Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution

PDB Compounds: (C:) Fab X5, light chain

SCOPe Domain Sequences for d1rhhc1:

Sequence; same for both SEQRES and ATOM records:

>d1rhhc1 b.1.1.1 (C:1-106A) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
elvltqspgtlslsageratlscrasqsvssgslawyqqkpgqaprlliygastratgip
drfsgsgsgtdftltigrlepedlavyycqqygtspytfgqgtkleik

Timeline for d1rhhc1:

• d1rhhc1 first appeared in SCOP 1.67
  
• d1rhhc1 appears in SCOP 1.75
  
• d1rhhc1 appears in SCOPe 2.02
  
• d1rhhc1 appears in the current release, SCOPe 2.08