Lineage for d1rhhb2 (1rhh B:114-216)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655149Domain d1rhhb2: 1rhh B:114-216 [97476]
    Other proteins in same PDB: d1rhha1, d1rhha2, d1rhhb1, d1rhhc1, d1rhhc2, d1rhhd1

Details for d1rhhb2

PDB Entry: 1rhh (more details), 1.9 Å

PDB Description: Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution
PDB Compounds: (B:) Fab X5, heavy chain

SCOP Domain Sequences for d1rhhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhhb2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1rhhb2:

Click to download the PDB-style file with coordinates for d1rhhb2.
(The format of our PDB-style files is described here.)

Timeline for d1rhhb2: