Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1rhhb2: 1rhh B:114-216 [97476] Other proteins in same PDB: d1rhha1, d1rhha2, d1rhhb1, d1rhhc1, d1rhhc2, d1rhhd1 |
PDB Entry: 1rhh (more details), 1.9 Å
SCOP Domain Sequences for d1rhhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhhb2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1rhhb2: