SCOPe 2.05: Domain d1rhhb1: 1rhh B:3-113

Lineage for d1rhhb1 (1rhh B:3-113)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)

8. Domain d1rhhb1: 1rhh B:3-113 [97475]
   Other proteins in same PDB: d1rhha1, d1rhha2, d1rhhb2, d1rhhc1, d1rhhc2, d1rhhd2
   part of HIV-1 neutralizing Fab x5

Details for d1rhhb1

PDB Entry: 1rhh, 1.9 Å

PDB Description: Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution

PDB Compounds: (B:) Fab X5, heavy chain

SCOPe Domain Sequences for d1rhhb1:

Sequence; same for both SEQRES and ATOM records:

>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
qlleqsgaevkkpgssvqvsckasggtfsmygfnwvrqapghglewmggiipifgtsnya
qkfrgrvtftadqatstaymeltnlrsddtavyycardfgpdwedgdsydgsgrgffdfw
gqgtlvtvss

Timeline for d1rhhb1:

• d1rhhb1 first appeared in SCOP 1.67
  
• d1rhhb1 appears in SCOPe 2.04
  
• d1rhhb1 appears in SCOPe 2.06
  
• d1rhhb1 appears in the current release, SCOPe 2.08