Lineage for d1rhha2 (1rhh A:107-213)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549708Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549729Domain d1rhha2: 1rhh A:107-213 [97474]
    Other proteins in same PDB: d1rhha1, d1rhhb1, d1rhhb2, d1rhhc1, d1rhhd1, d1rhhd2

Details for d1rhha2

PDB Entry: 1rhh (more details), 1.9 Å

PDB Description: Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution

SCOP Domain Sequences for d1rhha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhha2 b.1.1.2 (A:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
srdstyslgstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1rhha2:

Click to download the PDB-style file with coordinates for d1rhha2.
(The format of our PDB-style files is described here.)

Timeline for d1rhha2: