Lineage for d1rhfb2 (1rhf B:98-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753957Protein Tyrosine-protein kinase receptor tyro3, second domain [101517] (1 species)
  7. 2753958Species Human (Homo sapiens) [TaxId:9606] [101518] (1 PDB entry)
  8. 2753960Domain d1rhfb2: 1rhf B:98-182 [97472]
    Other proteins in same PDB: d1rhfa1, d1rhfb1
    complexed with act, epe, zn

Details for d1rhfb2

PDB Entry: 1rhf (more details), 1.96 Å

PDB Description: crystal structure of human tyro3-d1d2
PDB Compounds: (B:) Tyrosine-protein kinase receptor TYRO3

SCOPe Domain Sequences for d1rhfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhfb2 b.1.1.4 (B:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]}
vpfftvepkdlavppnapfqlsceavgppepvtivwwrgttkiggpapspsvlnvtgvtq
stmfsceahnlkglassrtatvhlq

SCOPe Domain Coordinates for d1rhfb2:

Click to download the PDB-style file with coordinates for d1rhfb2.
(The format of our PDB-style files is described here.)

Timeline for d1rhfb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rhfb1