Lineage for d1rhfa2 (1rhf A:98-182)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454969Protein Tyrosine-protein kinase receptor tyro3, second domain [101517] (1 species)
  7. 454970Species Human (Homo sapiens) [TaxId:9606] [101518] (1 PDB entry)
  8. 454971Domain d1rhfa2: 1rhf A:98-182 [97470]
    Other proteins in same PDB: d1rhfa1, d1rhfb1

Details for d1rhfa2

PDB Entry: 1rhf (more details), 1.96 Å

PDB Description: crystal structure of human tyro3-d1d2

SCOP Domain Sequences for d1rhfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens)}
vpfftvepkdlavppnapfqlsceavgppepvtivwwrgttkiggpapspsvlnvtgvtq
stmfsceahnlkglassrtatvhlq

SCOP Domain Coordinates for d1rhfa2:

Click to download the PDB-style file with coordinates for d1rhfa2.
(The format of our PDB-style files is described here.)

Timeline for d1rhfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rhfa1