Class b: All beta proteins [48724] (149 folds) |
Fold b.7: C2 domain-like [49561] (4 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) two constituent families are related by circular permutation |
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins) topologically similar to the C-terminal domain of PapD |
Protein Piccolo [101566] (1 species) |
Species Rat (Rattus norvegicus ) [TaxId:10116] [101567] (1 PDB entry) |
Domain d1rh8a_: 1rh8 A: [97467] first C2 domain |
PDB Entry: 1rh8 (more details)
SCOP Domain Sequences for d1rh8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus )} ashpitgeiqlqinydlgnliihilqarnlvprdnngysdpfvkvyllpgrgqvmvvqna saeykrrtkyvqkslnpewnqtviyksismeqlmkktlevtvwdydrfssndflgevlid lsstshldntprwyplkeqtes
Timeline for d1rh8a_: