Lineage for d1rh8a_ (1rh8 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369767Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 369768Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 369819Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (7 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 369830Protein Piccolo [101566] (1 species)
  7. 369831Species Rat (Rattus norvegicus ) [TaxId:10116] [101567] (1 PDB entry)
  8. 369832Domain d1rh8a_: 1rh8 A: [97467]
    first C2 domain

Details for d1rh8a_

PDB Entry: 1rh8 (more details)

PDB Description: three-dimensional structure of the calcium-free piccolo c2a-domain

SCOP Domain Sequences for d1rh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus )}
ashpitgeiqlqinydlgnliihilqarnlvprdnngysdpfvkvyllpgrgqvmvvqna
saeykrrtkyvqkslnpewnqtviyksismeqlmkktlevtvwdydrfssndflgevlid
lsstshldntprwyplkeqtes

SCOP Domain Coordinates for d1rh8a_:

Click to download the PDB-style file with coordinates for d1rh8a_.
(The format of our PDB-style files is described here.)

Timeline for d1rh8a_: