Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.6: Sec-beta or SecG subunit of protein translocation channel [267595] (2 families) |
Family f.17.6.1: Sec-beta subunit [267608] (1 protein) |
Protein Sec-beta subunit [267634] (2 species) |
Species Methanococcus jannaschii [TaxId:2190] [267695] (4 PDB entries) |
Domain d1rh5c_: 1rh5 C: [97466] Other proteins in same PDB: d1rh5a_, d1rh5b_ |
PDB Entry: 1rh5 (more details), 3.2 Å
SCOPe Domain Sequences for d1rh5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rh5c_ f.17.6.1 (C:) Sec-beta subunit {Methanococcus jannaschii [TaxId: 2190]} etfskirvkpehvigvtvafviieailtygrf
Timeline for d1rh5c_: