Lineage for d1rh5c_ (1rh5 C:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698625Superfamily f.23.29: Sec-beta subunit [103460] (1 family) (S)
  5. 1698626Family f.23.29.1: Sec-beta subunit [103461] (1 protein)
  6. 1698627Protein Sec-beta subunit [103462] (2 species)
  7. 1698630Species Methanococcus jannaschii [TaxId:2190] [103463] (4 PDB entries)
  8. 1698631Domain d1rh5c_: 1rh5 C: [97466]
    Other proteins in same PDB: d1rh5a_, d1rh5b_

Details for d1rh5c_

PDB Entry: 1rh5 (more details), 3.2 Å

PDB Description: the structure of a protein conducting channel
PDB Compounds: (C:) SecBeta

SCOPe Domain Sequences for d1rh5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rh5c_ f.23.29.1 (C:) Sec-beta subunit {Methanococcus jannaschii [TaxId: 2190]}
etfskirvkpehvigvtvafviieailtygrf

SCOPe Domain Coordinates for d1rh5c_:

Click to download the PDB-style file with coordinates for d1rh5c_.
(The format of our PDB-style files is described here.)

Timeline for d1rh5c_: