Lineage for d1rh5c_ (1rh5 C:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 520319Superfamily f.23.29: Sec-beta subunit [103460] (1 family) (S)
  5. 520320Family f.23.29.1: Sec-beta subunit [103461] (1 protein)
  6. 520321Protein Sec-beta subunit [103462] (1 species)
  7. 520322Species Archaeon Methanococcus jannaschii [TaxId:2190] [103463] (2 PDB entries)
  8. 520323Domain d1rh5c_: 1rh5 C: [97466]
    Other proteins in same PDB: d1rh5a_, d1rh5b_

Details for d1rh5c_

PDB Entry: 1rh5 (more details), 3.2 Å

PDB Description: the structure of a protein conducting channel

SCOP Domain Sequences for d1rh5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rh5c_ f.23.29.1 (C:) Sec-beta subunit {Archaeon Methanococcus jannaschii}
etfskirvkpehvigvtvafviieailtygrf

SCOP Domain Coordinates for d1rh5c_:

Click to download the PDB-style file with coordinates for d1rh5c_.
(The format of our PDB-style files is described here.)

Timeline for d1rh5c_: