| Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
| Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.29: Sec-beta subunit [103460] (1 family) ![]() |
| Family f.23.29.1: Sec-beta subunit [103461] (1 protein) |
| Protein Sec-beta subunit [103462] (1 species) |
| Species Archaeon Methanococcus jannaschii [TaxId:2190] [103463] (2 PDB entries) |
| Domain d1rh5c_: 1rh5 C: [97466] Other proteins in same PDB: d1rh5a_, d1rh5b_ mutant |
PDB Entry: 1rh5 (more details), 3.2 Å
SCOP Domain Sequences for d1rh5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rh5c_ f.23.29.1 (C:) Sec-beta subunit {Archaeon Methanococcus jannaschii}
etfskirvkpehvigvtvafviieailtygrf
Timeline for d1rh5c_: