SCOPe 2.05: Domain d1rh5b_: 1rh5 B:

Lineage for d1rh5b_ (1rh5 B:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family)

5. Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein)

6. Protein Preprotein translocase SecE subunit [103458] (3 species)

7. Species Methanococcus jannaschii [TaxId:2190] [103459] (4 PDB entries)

8. Domain d1rh5b_: 1rh5 B: [97465]
   Other proteins in same PDB: d1rh5a_, d1rh5c_

Details for d1rh5b_

PDB Entry: 1rh5, 3.2 Å

PDB Description: the structure of a protein conducting channel

PDB Compounds: (B:) Preprotein translocase secE subunit

SCOPe Domain Sequences for d1rh5b_:

Sequence; same for both SEQRES and ATOM records:

>d1rh5b_ f.23.28.1 (B:) Preprotein translocase SecE subunit {Methanococcus jannaschii [TaxId: 2190]}
lkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyikgilk

Timeline for d1rh5b_:

• d1rh5b_ first appeared in SCOP 1.67
  
• d1rh5b_ appears in SCOPe 2.04
  
• d1rh5b_ appears in SCOPe 2.06
  
• d1rh5b_ appears in the current release, SCOPe 2.08