Lineage for d1rh5b_ (1rh5 B:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958424Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family) (S)
  5. 1958425Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein)
  6. 1958426Protein Preprotein translocase SecE subunit [103458] (3 species)
  7. 1958429Species Methanococcus jannaschii [TaxId:2190] [103459] (4 PDB entries)
  8. 1958430Domain d1rh5b_: 1rh5 B: [97465]
    Other proteins in same PDB: d1rh5a_, d1rh5c_

Details for d1rh5b_

PDB Entry: 1rh5 (more details), 3.2 Å

PDB Description: the structure of a protein conducting channel
PDB Compounds: (B:) Preprotein translocase secE subunit

SCOPe Domain Sequences for d1rh5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rh5b_ f.23.28.1 (B:) Preprotein translocase SecE subunit {Methanococcus jannaschii [TaxId: 2190]}
lkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyikgilk

SCOPe Domain Coordinates for d1rh5b_:

Click to download the PDB-style file with coordinates for d1rh5b_.
(The format of our PDB-style files is described here.)

Timeline for d1rh5b_: