![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family) ![]() |
![]() | Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein) |
![]() | Protein Preprotein translocase SecE subunit [103458] (1 species) |
![]() | Species Archaeon Methanococcus jannaschii [TaxId:2190] [103459] (2 PDB entries) |
![]() | Domain d1rh5b_: 1rh5 B: [97465] Other proteins in same PDB: d1rh5a_, d1rh5c_ |
PDB Entry: 1rh5 (more details), 3.2 Å
SCOP Domain Sequences for d1rh5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rh5b_ f.23.28.1 (B:) Preprotein translocase SecE subunit {Archaeon Methanococcus jannaschii} lkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyikgilk
Timeline for d1rh5b_: