Lineage for d1rh5a_ (1rh5 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633597Fold f.41: Preprotein translocase SecY subunit [103490] (1 superfamily)
    10 transmembrane helices forming of a gated channel
  4. 2633598Superfamily f.41.1: Preprotein translocase SecY subunit [103491] (2 families) (S)
    duplication: consists of two similar structural parts
  5. 2633599Family f.41.1.1: Preprotein translocase SecY subunit [103492] (1 protein)
    automatically mapped to Pfam PF00344
  6. 2633600Protein Preprotein translocase SecY subunit [103493] (2 species)
  7. 2633601Species Methanococcus jannaschii [TaxId:2190] [103494] (2 PDB entries)
  8. 2633602Domain d1rh5a_: 1rh5 A: [97464]
    Other proteins in same PDB: d1rh5b_, d1rh5c_

Details for d1rh5a_

PDB Entry: 1rh5 (more details), 3.2 Å

PDB Description: the structure of a protein conducting channel
PDB Compounds: (A:) Preprotein translocase secY subunit

SCOPe Domain Sequences for d1rh5a_:

Sequence, based on SEQRES records: (download)

>d1rh5a_ f.41.1.1 (A:) Preprotein translocase SecY subunit {Methanococcus jannaschii [TaxId: 2190]}
kklipilekipevelpvkeitfkeklkwtgivlvlyfimgcidvytagaqipaifefwqt
itasrigtlitlgigpivtagiimqllvgsgiiqmdlsipenralfqgcqkllsiimcfv
eavlfvgagafgiltpllaflviiqiafgsiiliyldeivskygigsgiglfiaagvsqt
ifvgalgpegylwkflnsliqgvpnieyiapiigtiivflmvvyaecmrveiplahgrik
gavgkypikfvyvsnipvilaaalfaniqlwglalyrmgipilghyeggravdgiayyls
tpyglssvisdpihaivymiamiitcvmfgifwvettgldpksmakrigslgmaikgfrk
sekaiehrlkryippltvmssafvgflatianfigalgggtgvlltvsivyrmyeqllre
rt

Sequence, based on observed residues (ATOM records): (download)

>d1rh5a_ f.41.1.1 (A:) Preprotein translocase SecY subunit {Methanococcus jannaschii [TaxId: 2190]}
kklipilekipevelpvkeitfkeklkwtgivlvlyfimgcidvytagaqipaifefwqt
itasrigtlitlgigpivtagiimqllvgsgiiqmdlsipenralfqgcqkllsiimcfv
eavlfvgagafgiltpllaflviiqiafgsiiliyldeivskygigsgiglfiaagvsqt
ifvgalgpegylwkflnsliqgvpnieyiapiigtiivflmvvyaecmrveiplahgrik
gavgkypikfvyvsnipvilaaalfaniqlwglalyrmgipilghyeggravdgiayyls
tpyglssvisdpihaivymiamiitcvmfgifwvettgldpksmakrisekaiehrlkry
ippltvmssafvgflatianfigalgggtgvlltvsivyrmyeqllrert

SCOPe Domain Coordinates for d1rh5a_:

Click to download the PDB-style file with coordinates for d1rh5a_.
(The format of our PDB-style files is described here.)

Timeline for d1rh5a_: