![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.1: Colicin [56837] (1 family) ![]() |
![]() | Family f.1.1.1: Colicin [56838] (4 proteins) contains "globin-like fold" with additional N-terminal and C-terminal helices |
![]() | Protein Colicin B C-terminal domain [103421] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103422] (1 PDB entry) |
![]() | Domain d1rh1a2: 1rh1 A:313-511 [97463] Other proteins in same PDB: d1rh1a1 |
PDB Entry: 1rh1 (more details), 2.5 Å
SCOPe Domain Sequences for d1rh1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rh1a2 f.1.1.1 (A:313-511) Colicin B C-terminal domain {Escherichia coli [TaxId: 562]} eqendektvltktseviisvgdkvgeylgdkykalsreiaeninnfqgktirsyddamss inklmanpslkinatdkeaivnawkafnaedmgnkfaalgktfkaadyaikannireksi egyqtgnwgplmleveswvisgmasavalslfsltlgsaliafglsatvvgfvgvviaga igafiddkfvdelnhkiik
Timeline for d1rh1a2: