Lineage for d1rh1a2 (1rh1 A:313-511)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. Superfamily f.1.1: Colicin [56837] (1 family) (S)
  5. Family f.1.1.1: Colicin [56838] (4 proteins)
    contains "globin-like fold" with additional N-terminal and C-terminal helices
  6. Protein Colicin B C-terminal domain [103421] (1 species)
  7. Species Escherichia coli [TaxId:562] [103422] (1 PDB entry)
  8. Domain d1rh1a2: 1rh1 A:313-511 [97463]
    Other proteins in same PDB: d1rh1a1

Details for d1rh1a2

PDB Entry: 1rh1 (more details), 2.5 Å

PDB Description: crystal structure of the cytotoxic bacterial protein colicin B at 2.5 A resolution
PDB Compounds: (A:) Colicin B

SCOPe Domain Sequences for d1rh1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rh1a2 f.1.1.1 (A:313-511) Colicin B C-terminal domain {Escherichia coli [TaxId: 562]}
eqendektvltktseviisvgdkvgeylgdkykalsreiaeninnfqgktirsyddamss
inklmanpslkinatdkeaivnawkafnaedmgnkfaalgktfkaadyaikannireksi
egyqtgnwgplmleveswvisgmasavalslfsltlgsaliafglsatvvgfvgvviaga
igafiddkfvdelnhkiik

SCOPe Domain Coordinates for d1rh1a2 are not available.

Timeline for d1rh1a2:

Domains from same chain:
(mouse over for more information)
d1rh1a1