Lineage for d1rh1a1 (1rh1 A:10-312)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075111Fold b.110: Cloacin translocation domain [69368] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 2075112Superfamily b.110.1: Cloacin translocation domain [69369] (1 family) (S)
    automatically mapped to Pfam PF03515
  5. 2075113Family b.110.1.1: Cloacin translocation domain [69370] (2 protein domains)
    Pfam PF03515
  6. 2075114Protein Colicin B N-terminal domain [102013] (1 species)
  7. 2075115Species Escherichia coli [TaxId:562] [102014] (1 PDB entry)
  8. 2075116Domain d1rh1a1: 1rh1 A:10-312 [97462]
    Other proteins in same PDB: d1rh1a2

Details for d1rh1a1

PDB Entry: 1rh1 (more details), 2.5 Å

PDB Description: crystal structure of the cytotoxic bacterial protein colicin B at 2.5 A resolution
PDB Compounds: (A:) Colicin B

SCOPe Domain Sequences for d1rh1a1:

Sequence, based on SEQRES records: (download)

>d1rh1a1 b.110.1.1 (A:10-312) Colicin B N-terminal domain {Escherichia coli [TaxId: 562]}
tegidygdtmvvwpstgripggdvkpggssglapsmppgwgdyspqgialvqsvlfpgii
rriildkeleegdwsgwsvsvhspwgnekvsaartvlenglrgglpepsrpaavsfarle
pasgneqkiirlmvtqqleqvtdipasqlpaagnnvpvkyrltdlmqngtqymaiiggip
mtvpvvdavpvpdrsrpgtnikdvysapvspnlpdlvlsvgqmntpvrsnpeiqedgvis
etgnyveagytmssnnhdvivrfpegsgvsplyisaveildsnslsqrqeaennakddfr
vkk

Sequence, based on observed residues (ATOM records): (download)

>d1rh1a1 b.110.1.1 (A:10-312) Colicin B N-terminal domain {Escherichia coli [TaxId: 562]}
tegidygdtmvvwpstgripggsmppgwgdyspqgialvqsvlfpgiirriildkeleeg
dwsgwsvsvhspwgnekvsaartvlenglrgglpepsrpaavsfarlepasgneqkiirl
mvtqqleqvtdipasqlpaagnnvpvkyrltdlmqngtqymaiiggipmtvpvvdavpvp
drsrpgtnikdvysapvspnlpdlvlsvgqmntpvrsnpeiqedgvisetgnyveagytm
ssnnhdvivrfpegsgvsplyisaveildsnslsqrqeaennakddfrvkk

SCOPe Domain Coordinates for d1rh1a1:

Click to download the PDB-style file with coordinates for d1rh1a1.
(The format of our PDB-style files is described here.)

Timeline for d1rh1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rh1a2