Lineage for d1rgya_ (1rgy A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450076Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1450077Species Citrobacter freundii [TaxId:546] [56619] (3 PDB entries)
  8. 1450078Domain d1rgya_: 1rgy A: [97456]
    complexed with mpd, ptx

Details for d1rgya_

PDB Entry: 1rgy (more details), 1.52 Å

PDB Description: Citrobacter freundii GN346 Class C beta-Lactamase Complexed with Transition-State Analog of Cefotaxime
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1rgya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgya_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Citrobacter freundii [TaxId: 546]}
akteqqiadivnrtitplmqeqaipgmavaiiyegkpyyftwgkadiannhpvtqqtlfe
lgsvsktfngvlggdaiargeiklsdpvtkywpeltgkqwrgisllhlatytagglplqi
pdditdkaallrfyqnwqpqwtpgakrlyanssiglfgalavkpsgmsyeeamtrrvlqp
lklahtwitvpqseqknyawgyregkpvhvspgqldaeaygvkssvidmarwvqanmdas
hvqektlqqgielaqsrywrigdmyqglgwemlnwplkadsiingsdskvalaalpavev
nppvpavkaswvhktgstggfgsyvafvpeknlgivmlanksypnpvrveaawrileklq

SCOPe Domain Coordinates for d1rgya_:

Click to download the PDB-style file with coordinates for d1rgya_.
(The format of our PDB-style files is described here.)

Timeline for d1rgya_: