SCOPe 2.05: Domain d1rgva_: 1rgv A:

Lineage for d1rgva_ (1rgv A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
   contains two 4Fe-4S clusters

6. Protein Ferredoxin II [54864] (5 species)

7. Species Thauera aromatica [TaxId:59405] [102954] (1 PDB entry)

8. Domain d1rgva_: 1rgv A: [97454]
   complexed with sf4

Details for d1rgva_

PDB Entry: 1rgv, 2.9 Å

PDB Description: Crystal Structure of the Ferredoxin from Thauera aromatica

PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1rgva_:

Sequence; same for both SEQRES and ATOM records:

>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]}
alyinddctacdacveecpneaitpgdpiyvidptkcsecvgafdepqcrlvcpadcipd
npdyretreelqekydrlhg

Timeline for d1rgva_:

• d1rgva_ first appeared in SCOP 1.67
  
• d1rgva_ appears in SCOPe 2.04
  
• d1rgva_ appears in SCOPe 2.06
  
• d1rgva_ appears in the current release, SCOPe 2.08