![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.66: CCCH zinc finger [90228] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.66.1: CCCH zinc finger [90229] (2 families) ![]() |
![]() | Family g.66.1.1: CCCH zinc finger [90230] (4 proteins) C-x8-C-x5-C-x3-H type and similar |
![]() | Protein Butyrate response factor 2 (Tis11D) [103632] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103633] (1 PDB entry) |
![]() | Domain d1rgoa1: 1rgo A:151-186 [97444] complexed with zn |
PDB Entry: 1rgo (more details)
SCOPe Domain Sequences for d1rgoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} stryktelcrpfeesgtckygekcqfahgfhelrsl
Timeline for d1rgoa1: