Lineage for d1rgoa1 (1rgo A:151-186)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038401Fold g.66: CCCH zinc finger [90228] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038402Superfamily g.66.1: CCCH zinc finger [90229] (2 families) (S)
  5. 3038403Family g.66.1.1: CCCH zinc finger [90230] (4 proteins)
    C-x8-C-x5-C-x3-H type and similar
  6. 3038404Protein Butyrate response factor 2 (Tis11D) [103632] (1 species)
  7. 3038405Species Human (Homo sapiens) [TaxId:9606] [103633] (1 PDB entry)
  8. 3038406Domain d1rgoa1: 1rgo A:151-186 [97444]
    complexed with zn

Details for d1rgoa1

PDB Entry: 1rgo (more details)

PDB Description: structural basis for recognition of the mrna class ii au-rich element by the tandem zinc finger domain of tis11d
PDB Compounds: (A:) Butyrate response factor 2

SCOPe Domain Sequences for d1rgoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]}
stryktelcrpfeesgtckygekcqfahgfhelrsl

SCOPe Domain Coordinates for d1rgoa1:

Click to download the PDB-style file with coordinates for d1rgoa1.
(The format of our PDB-style files is described here.)

Timeline for d1rgoa1: