Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1rgnl_ (1rgn L:)

  1. Root: SCOP 1.75B
  2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. Protein L (light) subunit [81477] (3 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (49 PDB entries)
    Uniprot P02954
  8. Domain d1rgnl_: 1rgn L: [97442]
    Other proteins in same PDB: d1rgnh1, d1rgnh2, d1rgnm_
    complexed with bcl, bph, fe, lda, po4, spo, u10

Details for d1rgnl_

PDB Entry: 1rgn (more details)
PDB Description: structure of the reaction centre from rhodobacter sphaeroide carotenoidless strain r-26.1 reconstituted with spheroidene
PDB Compounds: (L:) reaction center protein l chain

SCOP Domain Sequences for d1rgnl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgnl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d1rgnl_:

Click to download the PDB-style file with coordinates for d1rgnl_.
(The format of our PDB-style files is described here.)

Timeline for d1rgnl_:

d1rgnl_ appears in SCOP 1.75A


d1rgnl_
(click for larger image)


d1rgnl_ in context of chain



d1rgnl_ in context of PDB
Domains from other chains:
d1rgnh1, d1rgnh2, d1rgnm_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu