![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
![]() | Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
![]() | Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins) |
![]() | Protein S-adenosylmethionine synthetase [55975] (3 species) synonym: methionine adenosyltransferase, MAT |
![]() | Species Escherichia coli [TaxId:562] [55976] (9 PDB entries) |
![]() | Domain d1rg9c2: 1rg9 C:103-231 [97434] complexed with k, mg, ppk, sam |
PDB Entry: 1rg9 (more details), 2.5 Å
SCOPe Domain Sequences for d1rg9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rg9c2 d.130.1.1 (C:103-231) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]} nqgvdradpleqgagdqglmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrp daksqvtfqyddgkivgidavvlstqhseeidqkslqeavmeeiikpilpaewltsatkf finptgrfv
Timeline for d1rg9c2: