SCOPe 2.05: Domain d1rg5l_: 1rg5 L:

Lineage for d1rg5l_ (1rg5 L:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (61 PDB entries)
   Uniprot P02954

8. Domain d1rg5l_: 1rg5 L: [97425]
   Other proteins in same PDB: d1rg5h1, d1rg5h2, d1rg5m_
   complexed with bcl, bph, cdl, fe, hto, lda, u10

Details for d1rg5l_

PDB Entry: 1rg5, 2.5 Å

PDB Description: structure of the photosynthetic reaction centre from rhodobacter sphaeroides carotenoidless strain r-26.1

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d1rg5l_:

Sequence; same for both SEQRES and ATOM records:

>d1rg5l_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1rg5l_:

• d1rg5l_ first appeared in SCOP 1.67
  
• d1rg5l_ appears in SCOPe 2.04
  
• d1rg5l_ appears in SCOPe 2.06
  
• d1rg5l_ appears in the current release, SCOPe 2.08