SCOPe 2.05: Domain d1rfzc_: 1rfz C:

Lineage for d1rfzc_ (1rfz C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.195: YutG-like [101306] (1 superfamily)
   core: 6 helices; bundle; one central helix is surrounded by 5 others

4. Superfamily a.195.1: YutG-like [101307] (1 family)

5. Family a.195.1.1: YutG-like [101308] (3 proteins)
   Pfam PF01892; DUF64

6. Protein YutG homologue [101309] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [101310] (1 PDB entry)

8. Domain d1rfzc_: 1rfz C: [97413]
   structural genomics; MCSG target APC35681
   complexed with so4

Details for d1rfzc_

PDB Entry: 1rfz, 2.8 Å

PDB Description: Structure of Protein of Unknown Function from Bacillus stearothermophilus

PDB Compounds: (C:) Hypothetical protein APC35681

SCOPe Domain Sequences for d1rfzc_:

Sequence; same for both SEQRES and ATOM records:

>d1rfzc_ a.195.1.1 (C:) YutG homologue {Bacillus stearothermophilus [TaxId: 1422]}
sefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrviskrevq
nailtgiqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnygyidk
qkpgilqylndkstgkcntflddivgaiaaaassrlahraa

Timeline for d1rfzc_:

• d1rfzc_ first appeared in SCOP 1.67
  
• d1rfzc_ appears in SCOPe 2.04
  
• d1rfzc_ appears in SCOPe 2.06
  
• d1rfzc_ appears in the current release, SCOPe 2.08