SCOP 1.71: Domain d1rfzb_: 1rfz B:

Lineage for d1rfzb_ (1rfz B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.195: YutG-like [101306] (1 superfamily)
   core: 6 helices; bundle; one central helix is surrounded by 5 others

4. Superfamily a.195.1: YutG-like [101307] (1 family)

5. Family a.195.1.1: YutG-like [101308] (3 proteins)
   Pfam 01892; DUF64

6. Protein YutG homologue [101309] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [101310] (1 PDB entry)

8. Domain d1rfzb_: 1rfz B: [97412]

Details for d1rfzb_

PDB Entry: 1rfz, 2.8 Å

PDB Description: Structure of Protein of Unknown Function from Bacillus stearothermophilus

SCOP Domain Sequences for d1rfzb_:

Sequence; same for both SEQRES and ATOM records:

>d1rfzb_ a.195.1.1 (B:) YutG homologue {Bacillus stearothermophilus}
snamsefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrvisk
revqnailtgiqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnyg
yidkqkpgilqylndkstgkcntflddivgaiaaaassrlahra

Timeline for d1rfzb_:

• d1rfzb_ first appeared in SCOP 1.67
  
• d1rfzb_ appears in SCOP 1.69
  
• d1rfzb_ appears in SCOP 1.73
  
• d1rfzb_ appears in the current release, SCOPe 2.08