Lineage for d1rfvb_ (1rfv B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843354Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 843355Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 843502Family c.72.1.5: PfkB-like kinase [82515] (2 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 843503Protein Pyridoxal kinase [82516] (1 species)
  7. 843504Species Sheep (Ovis aries) [TaxId:9940] [82517] (8 PDB entries)
  8. 843510Domain d1rfvb_: 1rfv B: [97410]
    complexed with adp, zn2

Details for d1rfvb_

PDB Entry: 1rfv (more details), 2.8 Å

PDB Description: Crystal structure of pyridoxal kinase complexed with ADP
PDB Compounds: (B:) Pyridoxal kinase

SCOP Domain Sequences for d1rfvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfvb_ c.72.1.5 (B:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]}
ecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelq
elydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrnge
gamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtv
vitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaamlla
wthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiesp
eivvqatvl

SCOP Domain Coordinates for d1rfvb_:

Click to download the PDB-style file with coordinates for d1rfvb_.
(The format of our PDB-style files is described here.)

Timeline for d1rfvb_: