Lineage for d1rfib1 (1rfi B:162-350)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511483Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 511484Superfamily d.136.1: Phospholipase D/nuclease [56024] (3 families) (S)
  5. 511509Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (1 protein)
  6. 511510Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species)
  7. 511520Species Human (Homo sapiens) [TaxId:9606] [69817] (12 PDB entries)
  8. 511549Domain d1rfib1: 1rfi B:162-350 [97382]

Details for d1rfib1

PDB Entry: 1rfi (more details), 2.2 Å

PDB Description: crystal structure of human tyrosyl-dna phosphodiesterase complexed with vanadate, pentapeptide klnyk, and tetranucleotide agtc

SCOP Domain Sequences for d1rfib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfib1 d.136.1.3 (B:162-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens)}
npfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdvdwlvkqyppefrk
kpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmmlllyeeglrvviht
snlihadwhqktqgiwlsplypriadgthksgespthfkanlisyltaynapslkewidv
ihkhdlset

SCOP Domain Coordinates for d1rfib1:

Click to download the PDB-style file with coordinates for d1rfib1.
(The format of our PDB-style files is described here.)

Timeline for d1rfib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rfib2