Lineage for d1rffa1 (1rff A:162-350)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511483Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 511484Superfamily d.136.1: Phospholipase D/nuclease [56024] (3 families) (S)
  5. 511509Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (1 protein)
  6. 511510Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species)
  7. 511520Species Human (Homo sapiens) [TaxId:9606] [69817] (12 PDB entries)
  8. 511523Domain d1rffa1: 1rff A:162-350 [97376]

Details for d1rffa1

PDB Entry: 1rff (more details), 1.7 Å

PDB Description: crystal structure of human tyrosyl-dna phosphodiesterase complexed with vanadate, octapeptide klnyydpr, and tetranucleotide agtt.

SCOP Domain Sequences for d1rffa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rffa1 d.136.1.3 (A:162-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens)}
npfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdvdwlvkqyppefrk
kpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmmlllyeeglrvviht
snlihadwhqktqgiwlsplypriadgthksgespthfkanlisyltaynapslkewidv
ihkhdlset

SCOP Domain Coordinates for d1rffa1:

Click to download the PDB-style file with coordinates for d1rffa1.
(The format of our PDB-style files is described here.)

Timeline for d1rffa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rffa2