SCOP 1.71: Domain d1rfdh1: 1rfd H:1-113

Lineage for d1rfdh1 (1rfd H:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (42 PDB entries)

8. Domain d1rfdh1: 1rfd H:1-113 [97372]
   Other proteins in same PDB: d1rfdh2, d1rfdl1, d1rfdl2
   part of anti-cocaine Fab M82G2

Details for d1rfdh1

PDB Entry: 1rfd, 2.09 Å

PDB Description: anti-cocaine antibody m82g2

SCOP Domain Sequences for d1rfdh1:

Sequence; same for both SEQRES and ATOM records:

>d1rfdh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
a

Timeline for d1rfdh1:

• d1rfdh1 first appeared in SCOP 1.67
  
• d1rfdh1 appears in SCOP 1.69
  
• d1rfdh1 appears in SCOP 1.73
  
• d1rfdh1 appears in the current release, SCOPe 2.08